PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013609378.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family EIL
Protein Properties Length: 547aa    MW: 62342.5 Da    PI: 6.6285
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013609378.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3348.71.2e-106454051354
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     eel+k+ wkd+++lk+lke++k+ l++++      k+    e++r++ m +aQDgiLkYM k+me c+aqGfvYg + ++gk+v+g+sd+Lr+WW
  XP_013609378.1  45 EELEKKIWKDKQRLKQLKEMSKNGLGRASL-----KQPPDDEHSRKRMMYQAQDGILKYMSKTMERCKAQGFVYGVVFQNGKTVTGSSDNLRGWW 134
                     8**********************9866555.....678999****************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXX.XXXXXX.......XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT- CS
            EIN3  96 kekvefdrngpaaiskyqaknlil.sgessl.qt..ersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgl 186
                     +++v+fdrngpaai k+q + +++ +++++l  +   ++ + h+l elqDTtlg+LLsalm  c+ppqrr+plekgv+pPWWPtGke+wwg l l
  XP_013609378.1 135 RDQVRFDRNGPAAILKHQREINLSaTDGNELgYSedGGECTAHKLLELQDTTLGALLSALMPNCKPPQRRYPLEKGVPPPWWPTGKEDWWGDLPL 229
                     *****************7765554144454443311356679***************************************************** PP

                     -TT--...-----GGG--HHHHHHHHHHHHHHT.GGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX..XXXX.....XX CS
            EIN3 187 skdqg..tppykkphdlkkawkvsvLtavikhm.sptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss..slrk.....qs 271
                     +   +  +p y+kph lkk+wkv++L  vi+hm + +i+ i +l+ +s  lq+km+++e   +l+ ln+e++++ + + ++   s  +     ++
  XP_013609378.1 230 PDGCRghPPAYRKPHGLKKMWKVGILIGVIRHMmASDINDIAKLVGRSTTLQEKMTSREGSLWLAALNREKAIASQSQEQPLtfS--EedgtgGE 322
                     ****999*************************85799*********************************998888887744331..22344588 PP

                     XXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX..XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
            EIN3 272 pkvtlsceqkedvegkkeskikhvqavktta..gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqney 354
                     +++ + + +++dveg   ++ +  ++ +  +  +f+ v   k+  + +      ++  tc++s +++s +e++f+d+  ++++++
  XP_013609378.1 323 TDTLFPEPADYDVEGSVGPRHRLNRQFHGFDnnNFNSVYNNKR--RFEGESLHPGTNLTCENSPCPYSRPEMGFNDRVLRENHQM 405
                     999999999*****77666655555555444125666666553..3333334455679*************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.3E-10345300No hitNo description
Gene3DG3DSA:1.10.3180.101.3E-55172307IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167687.06E-49176303IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MYNTNIGMFP TLVTSPVPRF PEGETCFASL NTTCNDPTEE EMEIEELEKK IWKDKQRLKQ  60
LKEMSKNGLG RASLKQPPDD EHSRKRMMYQ AQDGILKYMS KTMERCKAQG FVYGVVFQNG  120
KTVTGSSDNL RGWWRDQVRF DRNGPAAILK HQREINLSAT DGNELGYSED GGECTAHKLL  180
ELQDTTLGAL LSALMPNCKP PQRRYPLEKG VPPPWWPTGK EDWWGDLPLP DGCRGHPPAY  240
RKPHGLKKMW KVGILIGVIR HMMASDINDI AKLVGRSTTL QEKMTSREGS LWLAALNREK  300
AIASQSQEQP LTFSEEDGTG GETDTLFPEP ADYDVEGSVG PRHRLNRQFH GFDNNNFNSV  360
YNNKRRFEGE SLHPGTNLTC ENSPCPYSRP EMGFNDRVLR ENHQMTCPYK QPTEPFYQPA  420
EPFGMPYPDY NRSFYGNRPE SQVGMQQQQQ QQQVQSIPDN FTQSNNLYRP KAAERGGNTS  480
VMNHNTNNGY AQTVGMENYH QNTNNGYAQT VGMENYHKNT NNGYAQTVGM ENYHQNQDQD  540
LSMPWIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A8e-471753052129Protein ETHYLENE INSENSITIVE 3
4zds_B8e-471753052129Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895830.0AC189583.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH012D09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013609378.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 2 protein
SwissprotO231150.0EIL2_ARATH; ETHYLENE INSENSITIVE 3-like 2 protein
TrEMBLA0A0D3EDJ30.0A0A0D3EDJ3_BRAOL; Uncharacterized protein
STRINGBra002358.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147191621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G21120.10.0ETHYLENE-INSENSITIVE3-like 2